PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02207g11011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 287aa    MW: 31661.2 Da    PI: 7.3542
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02207g11011.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof128.71.7e-4052112262
                    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                               +++ lkcprCdstntkfCyynnysl+qPryfCk+CrryWtkGG+lrn+PvGgg+rknkk+s
  Niben101Scf02207g11011.1  52 HDQPLKCPRCDSTNTKFCYYNNYSLTQPRYFCKSCRRYWTKGGTLRNIPVGGGCRKNKKVS 112
                               7899******************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-2746106IPR003851Zinc finger, Dof-type
PfamPF027015.1E-3453110IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.44156110IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105894IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MGITSLQVCM DSSNWLQDTI HEETELDSSS SPSGDIFTCS RPLIERKLRP QHDQPLKCPR  60
CDSTNTKFCY YNNYSLTQPR YFCKSCRRYW TKGGTLRNIP VGGGCRKNKK VSSKKLSNEN  120
ATNYRNPGSS SSSISNFPEM AFSHFTNFMG NTSNFMLENP APIDFMESKY EALVGSSRNQ  180
DFLGNVDHLG MINGYGDING IAPNYHAGLG LCSTFGLPMD GNIMNYDGQN AIDVKPNPKV  240
LSLEWHDQGC SNSGNKESFG YFNGGLGSWT GLMNNGYGSS GTTNPLV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009774394.10.0PREDICTED: dof zinc finger protein DOF5.6-like
RefseqXP_016473208.10.0PREDICTED: dof zinc finger protein DOF5.6-like
SwissprotQ9FM032e-46DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLA0A0B6VJP10.0A0A0B6VJP1_TOBAC; Dof zinc finger protein